DPCstruct | MC2061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 331 ± 23 aa |
| Standard deviation of domain lengths | 22.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3SQJ6 | 226-566 | WGWGFFYIVSNKRVQMWHTFRSAAGTFCFEDYYRWHIDIMNLLFAHSIFPAAPEGIKARVRLDRIIYTDDVDKAVQGLVAEDGIAYH… |
| A0A1F7YFQ3 | 3-333 | ANPRDGKTLFASEFAYKPDYDFIPQDVGYSSYQQFLNAQYRVLSDVLVRAGVPGGIQARRLCVVAEGVVVDASWHLGWHDNGIKDSH… |
| A0A7X7FJ50 | 158-505 | None |
| A0A7Z8P6I9 | 309-647 | None |
| A0A2V8K988 | 55-367 | None |
| A0A7C5BKT2 | 353-666 | None |
| A0A1F5MIS6 | 88-434 | None |
| A0A3D1N058 | 40-307 | None |
| A0A814Q0C5 | 4-326 | None |
| A0A6G9AS26 | 2-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.