DPCstruct | MC20609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 3.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 72.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 74.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4PMW5 | 42-98 | ERDYIGFATLPEQVHRKSVKRGFDFTLMVVGESGLGKSTLINSLFLGDLYKGRKIPD |
| A0A3B3UMP5 | 6-71 | DFGGIFFLKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAE |
| A0A2A3E1K8 | 94-159 | None |
| A0A819YSX2 | 21-84 | None |
| A0A452TLX8 | 7-69 | None |
| A0A2I4CPW0 | 250-310 | None |
| A0A5M9JVJ3 | 52-119 | None |
| A0A7J7TK83 | 99-166 | None |
| I3L2M1 | 1-65 | None |
| A0A493TPY7 | 228-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.