DPCstruct | MC20608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 160 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0C6E7 | 23-161 | ATDAKGQDDILFVLISGGGSALLPMPRRPVDLKKKMSLVLELSNRGASIKELNIVRIALSDIKGGRLALAASRAHAVVSLIISDIVG… |
| A0A258ZED1 | 391-564 | LEMLRAANENTLVICLLSGGASALLVAPAEGLTLQDKQQMTRLLLNAGASIAELNTVRKHLSRVKGGRLAQAVYPGNLLTLIVSDVI… |
| A0A814D4Q3 | 738-908 | None |
| A0A177GES8 | 118-247 | None |
| U4UMQ4 | 155-271 | None |
| A0A2N6D8L7 | 105-236 | None |
| A0A2J6N7R3 | 18-178 | None |
| A0A2C9JCZ5 | 210-392 | None |
| A0A810Q683 | 131-308 | None |
| A0A0L7QNQ2 | 118-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.