DPCstruct | MC20606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564Z4U6 | 1-111 | MNFFRSIDSTDLPWTGAIFGLTVNAGWYWCTDEVIVQRCLAAKTMINSKAGIFLSMFINFMPLWLMITPDMTARILFADTVACDDIN… |
| A0A402G4V9 | 47-172 | KSHPGNSSCGLPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLAAKSLAHAKGGSLLASYLKILPLFMMVFPGM… |
| A0A5K3EX62 | 94-205 | None |
| A0A6S7GWI5 | 1-103 | None |
| A0A7J7F5P2 | 92-199 | None |
| A0A3Q3NGW1 | 92-205 | None |
| A0A816HK38 | 36-158 | None |
| A0A7D9K418 | 94-218 | None |
| A0A2C9LBC0 | 43-169 | None |
| A0A2G8KL14 | 56-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.