DPCstruct | MC20604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 253 ± 27 aa |
| Standard deviation of domain lengths | 26.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3VXN5 | 324-550 | SLPVVPDPPNLVEPNVEQIILSTMPNILPQHANALLTVDPSFVRYIIENHQHLDSLLGNMNAQTLHHIIAHVPEFGEILPNLSTSIL… |
| A0A564YZU1 | 47-269 | IKREILVSMPNIGYSSGNNLFFVNPSFARYIIARHWDPAGLLAHMDEPVLYKMIAINPGLDKRIASFTAEQIGAIFNRIYNHCHFLH… |
| A0A564YFE8 | 1-218 | None |
| A0A0R3TBY5 | 59-328 | None |
| A0A0R3T6S4 | 332-572 | None |
| A0A564YI28 | 66-322 | None |
| A0A087VXP2 | 365-600 | None |
| W6US91 | 427-676 | None |
| A0A564YGP3 | 136-362 | None |
| A0A0R3SSG7 | 155-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.