DPCstruct | MC20603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6E0P4 | 530-593 | AISFAQSENILGISAHTEELLKNLTFIADAQSKGLVVFSWGDDNNDHENRRTLREQGIDGLIYD |
| A0A7F8QDQ8 | 166-231 | AMSFAQFENLLGINAHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRKKLKELGVNGLIYDRF |
| A0A3S5FGD7 | 42-106 | None |
| A0A7R9PQ23 | 424-495 | None |
| A0A819V0D6 | 274-351 | None |
| A0A077Z5F6 | 229-293 | None |
| A0A1Y3ASP0 | 1-79 | None |
| A0A5J9TWF8 | 26-127 | None |
| A0A0C2DXB5 | 252-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.