DPCstruct | MC20601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6L9H0 | 38-116 | GTGKTTLSTDPKRLLIGDDEHGWDDEGVFNYEGGCYAKVINLDKESEPDIYNAIKRDALLENVTVDANGKIDFADKSTT |
| A0A0G0EJ49 | 220-304 | FGLSGTGKTTLSADPDRSLIGDDEHGWGQDGVFNFEGGCYAKCIRLKRESEPQIWVAIRRKGALLENVVLEKNGDLFTRLILSLI |
| A0A7S1BZT4 | 327-442 | None |
| A0A0N1HNT4 | 282-362 | None |
| A0A7V3QVW0 | 86-189 | None |
| A0A1Q9CBJ7 | 299-379 | None |
| A0A1F9VCU1 | 228-333 | None |
| A0A377DLL0 | 17-81 | None |
| A0A4Y7IHK3 | 701-782 | None |
| A0A2S6DIW7 | 76-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.