DPCstruct | MC20600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 171 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 63.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0VKS1 | 22-150 | ASAFSVGSAPGVGLSLRSRPAVSARSTQRAFGLRSLKAQEETVKYDDSIALAQKERLYLDACAAFNVDKKSLVSDDDFEQLKSDLAF… |
| A0A540NNH5 | 1-191 | MATKLGFTLTSTTPFNPSIQRPFVSVSSSSSTRVESFQISGRQLCLRLRRRRLLVLPAKATADQQGKVEKDDVVDSKILPYCSIDKK… |
| M1AXK4 | 1-165 | None |
| A0A7S0CSG1 | 55-205 | None |
| A0A5N6PI66 | 1-193 | None |
| A0A287T1J7 | 1-180 | None |
| A0A0G4EJP6 | 127-335 | None |
| A0A835QSM0 | 30-194 | None |
| A0A0D2KRW0 | 284-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.