DPCstruct | MC2060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9DX70 | 79-204 | PANFVVANLSIYINENDIQFVEFLNKASKQHIVLQLGFEVHDDFEKNYINGRVYISINEPKYSLYGGVAKVELSSKEVKFIFDDEGK… |
| A0A6L8VJF5 | 7-112 | IEIRAAYCEALDEDGEVLAAFATSDDPDEGYALFRQDGAKLWLEVSDDIFGAHDAIETITVDDARIAFVIRPAQVARLGMIRSVEIT… |
| A0A7Z9A1Y1 | 2-114 | None |
| A0A7Y8VV21 | 7-113 | None |
| A0A0F2DK87 | 98-209 | None |
| A0A1Q3LNP7 | 48-186 | None |
| A0A350AVB8 | 5-131 | None |
| A0A5N6FEV8 | 1-141 | None |
| A0A1Y5TRJ1 | 27-153 | None |
| A0A1M5M8K2 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.