DPCstruct | MC206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 226 ± 23 aa |
| Standard deviation of domain lengths | 23.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5XL98 | 328-558 | VDAANLQLAGAFGPYDKERIPAIQSAIASLPSDVVCVHESWGGSLRDGIAAAAASKFPHKASFNYDLDSLVDDATDQSGNDPPEWTE… |
| A0A7S1ICW6 | 5-216 | LVCPAMLSLRRRFAPLLRFLVALLAEGSTQAGISVATYNIGLLALTANHSTRYSANVRALESDQLEDVICLQDLWHDHEQRGLASAV… |
| K1PRX5 | 1-285 | None |
| A0A8B6H5Q4 | 21-243 | None |
| A0A8B6F287 | 29-226 | None |
| A0A1S3JT31 | 12-218 | None |
| A0A1S3H7N5 | 228-447 | None |
| A0A6J8BVI2 | 15-220 | None |
| A0A6J8BRS2 | 189-407 | None |
| A0A818Q6Y4 | 1-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.