DPCstruct | MC20599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 69 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6WGC5 | 185-253 | MHPIYKLLHPHMRYTLEINALARQNLINGGGIIEACFSPGKYSMEVSSAAYKSLWRFDMEALPADLISR |
| A0A540NMQ7 | 1-59 | MHVNALARGMLINFGGILEKTLFSAELSMQLSAELYKEWQFDEQALPADLLKRGMAIED |
| A0A6V7P8R5 | 271-339 | None |
| A0A1D6MV25 | 19-77 | None |
| A0A0D2ZYK1 | 1-52 | None |
| A0A3Q7ET25 | 124-207 | None |
| A0A251SEW0 | 166-234 | None |
| A0A287Q6Q8 | 89-157 | None |
| A0A7N2LAR2 | 170-259 | None |
| A0A396HHT1 | 17-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.