DPCstruct | MC20595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 295 ± 60 aa |
| Standard deviation of domain lengths | 59.90 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3NJI3 | 62-332 | NRVFTDPSPGKAGNKVTFSDLYIGALFNSSKCSKVLKDKMAETPAFAVEFAKICLLTNVGRINTTMAFFPEMKTALRSYHPVPSLQK… |
| A0A067TS88 | 35-324 | PIKRNDAEPLTREDVQYALLSYLFNNQRAVFTNPTNPKEPKLYFSDLYVTALYTSSKCSKVLKEKMLETPPFSIEFAKISLLTNVGR… |
| A0A4T0LG79 | 4-278 | None |
| C8V8H5 | 44-449 | None |
| A0A0F2M267 | 1-222 | None |
| A0A4T0PXQ3 | 97-344 | None |
| A0A4Z0A1T3 | 21-257 | None |
| J4HWS8 | 2-231 | None |
| R4XPS6 | 9-340 | None |
| A0A0G4MCF6 | 485-863 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.