DPCstruct | MC20592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1MKK9 | 8-149 | NCPLVMGDTDLCPWDMGTFGSLSTRHFGPTLVAAAAEAKAVLMELGAEALQTPVNRLKSKDGYIFDNEKPENKISYASLTKGKKIER… |
| A0A2V7ES60 | 106-231 | FTVGSRSVRSGFEPLRKAGAAAREMLIAAAALSWNVPRDACRARNGMVEHVPTGRRVGFGELTARAATLPVPADPPLKPISEFCILG… |
| A0A235HB02 | 50-166 | None |
| A0A7C3ECI3 | 84-226 | None |
| A0A6B0YDG6 | 95-242 | None |
| A0A3N5J039 | 110-238 | None |
| A0A1W9F4W3 | 21-163 | None |
| A0A354VMX5 | 1-130 | None |
| A0A354VH11 | 20-138 | None |
| A0A520IUQ3 | 170-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.