DPCstruct | MC20590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 803 |
|---|---|
| Mean domain length (aa) | 257 ± 55 aa |
| Standard deviation of domain lengths | 54.55 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.65 |
| Pfam Score | 97.99 |
| Assigned Pfam label(s) | PF04227- PF11807- CL0063- CL0118- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8E4R1 | 15-172 | VAAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAKTSIVCKVGKDSFGNDYIENLKQNDISTEFTCQ… |
| A0A7V1EAC1 | 6-281 | NHIVVIASFMMDLTTKLKKIPVRGETVFGEEFKIGPGGKGSNQAVCAKRLGLNITVVAKLGNDVFGREALNNFKKEGFETDFIFIDH… |
| A0A3D3EHA6 | 7-268 | None |
| A0A1Y2SLN0 | 2-181 | None |
| V4Y6W9 | 2-180 | None |
| A0A6A6L612 | 7-184 | None |
| A0A7C5U5G9 | 8-225 | None |
| A0A2R6CZN1 | 8-258 | None |
| A0A0D2NY90 | 12-241 | None |
| K2SLP9 | 285-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.