DPCstruct | MC2059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 190 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9APW9 | 85-277 | KEVGDILNALYKDNLERGLLHYNGRLHPSRYWAVSSNAIRVKDFKWAKSFIEQYKEQLIGENETRDIYRMNMANYFFGIGEYSKCLD… |
| A0A7T9DVY9 | 5-185 | SIFLNIYLQIELAAYKNYITLALKFNEINLAEKFLEKYKSHLQDEHKEEVYNFNKALILFEKKDYSSVIDLLLFLNFKDVFYKLNQR… |
| A0A7V5DCV5 | 153-344 | None |
| A0A3C2EG08 | 6-158 | None |
| A0A351F2R8 | 92-286 | None |
| A0A3B9AL50 | 336-547 | None |
| A0A7C5M8K8 | 284-481 | None |
| A0A3D0MUJ6 | 44-236 | None |
| A0A350V467 | 21-201 | None |
| A0A846FSK0 | 196-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.