DPCstruct | MC20587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 332 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 11.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 96.64 |
| Assigned Pfam label(s) | CL0341- CL0020- CL0418- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0D917 | 2-78 | SYVYLLESSDKATYVGATVDVDRRLRQHNKEISGGAHATGAKVAKGEIWHRVCYVKGFPDWQAALQFEWRWKQLSRK |
| A0A838LZ92 | 4-89 | VLWYLYLLECSDGSLYTGVTTDVARRWREHLSGKGARYTRSHMPLHLVASSPVGSRSDALRVELAIKRLPKTKKISAVQSLIHHSH |
| A0A7J6L122 | 609-702 | None |
| A0A554L827 | 180-252 | None |
| A0A3N7IEU7 | 3-97 | None |
| A0A6C2TX77 | 83-172 | None |
| A0A391NSB3 | 98-185 | None |
| A0A3M9MDC9 | 99-188 | None |
| M1YXF3 | 10-86 | None |
| M1V3X0 | 33-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.