DPCstruct | MC2058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 167 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437UDE5 | 111-272 | ESNLISVVAFYANMIIGIDADTFALEGGTKAFEMASNIVAQAQVTQEKGWMATSSQNRYFLVNDMLSPTFASYRKTIYDYHLGALDK… |
| A0A7T9DTS2 | 28-197 | STQLTSLLAFYANLFLAYDAESFAEDGGETFFQKALNISNNVPVNERSRYKGWSKLDGTRNRYALIDGWLNPRYKDFRKAFLMFHFN… |
| A0A368DA93 | 218-387 | None |
| A0A523HTS0 | 175-354 | None |
| A0A6G8CFA7 | 1-170 | None |
| A0A388Q0S4 | 3-142 | None |
| A0A7H5F0S6 | 140-311 | None |
| A0A2M7VRN1 | 1-160 | None |
| A0A7X3WET8 | 464-636 | None |
| A0A258DT11 | 93-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.