DPCstruct | MC20579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2NDC3 | 19-167 | VFLQAFIKNGDHYFVTEIKVYKDGRIDCWGMVDFNGFKEKVSKGWVRTHLPEGARVSMMVSGLYFTAHQVKSRVEEQEFVKEVEDEI… |
| A0A830L715 | 2-144 | ILTSIVIYEDGMFFLVETKTTHSLDEIAKMLSSGVLASKVSGEFTMVIPDFATLTVSGDYQTSSYSKFKEIKDLAAKVTKSKTSLEI… |
| A0A1Q3GRQ0 | 5-172 | None |
| A0A327VZX3 | 138-308 | None |
| I3CEQ1 | 64-189 | None |
| A0A495L9I8 | 18-166 | None |
| A0A371YNJ7 | 18-172 | None |
| A0A402CXB4 | 9-150 | None |
| A0A3N1A859 | 25-174 | None |
| A0A7W4D355 | 98-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.