DPCstruct | MC20578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M2EW76 | 6-151 | SWEQKTLITELIQGMELAKQLRAHLKATSSVETRDMLARRILSSYEKALLILNCGGSTGQPQNAGVSAGVPESPISINGSPRSDDFE… |
| A0A6A4QX61 | 2-124 | GNYGYNGIKAIEELVRGRECAKQLRDMMNGDDRSSLNEELIVKKVLMSFTNSLFLLNKNPTSQVNNPTISHESQQSNKERRGCYKRR… |
| A0A2U1NXC4 | 1-135 | None |
| A0A314YKU2 | 1-159 | None |
| I3SNF9 | 1-155 | None |
| A0A0U1ZB24 | 2-138 | None |
| A0A4V6DAF7 | 6-125 | None |
| A0A118K632 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.