DPCstruct | MC20577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZJ09 | 135-220 | VPPVDVDKVRCIIRNIVRDWAQEGQIERDECYKPILEELNRLFPDRSRPPSCLVPGAGLGRLALEISSLGFVSQGNEFSYYMMICS |
| A0A6M2EVS0 | 4-105 | HLGEHLVRCIIRNIVRDWAAEGMMRHCFPVSNSQKERDQCYKPILEELNSLFPSRCNKSPPTCLVPGAGLGRLVLEISCLGFVSQGN… |
| A0A2H9TPY0 | 122-219 | None |
| U6LHQ2 | 234-314 | None |
| A0A0V0ZVI3 | 87-199 | None |
| R1GHB2 | 67-164 | None |
| A0A834T2E8 | 377-463 | None |
| A0A2P2MED6 | 272-364 | None |
| A0A284QP30 | 110-214 | None |
| A0A0G4HL64 | 256-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.