DPCstruct | MC20576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 203 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M2EP33 | 1-198 | MPSKQKKFPCFWCFAAPVALYNSCLRMLNMRCLSIVFDLDETLIVANTMKSFEDRIEALRVWIAQSIMDPMRVLGMYVEMRRYIDDR… |
| A0A2C9U4Q6 | 146-339 | MLNLRCLGIVFDLDETLIVANTMRSFEDRIEALQRKISTEVDPQRLSGMLSEVKRYQDDKTILKQYVENDQVIENGRVIKTQFEVVP… |
| A0A0D2N424 | 3-229 | None |
| A0A6A6L8B4 | 69-262 | None |
| A0A5B8MTB1 | 168-367 | None |
| Q5N890 | 153-346 | None |
| A0A2U1LXU9 | 139-335 | None |
| A0A3B6GYE0 | 1-214 | None |
| A0A4S8J5T3 | 201-418 | None |
| A0A7S3E6A5 | 7-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.