DPCstruct | MC20574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 23.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9LLC7 | 1-96 | MSWYTPQELVGLPGLPGTEQNVRAFAKRHGWQGHRRLGSKAIEYPAAALPLETQVALMDLKSRAALAASAQALNDLADHHQALAEQL… |
| E8KH41 | 1-127 | MKEWFLAKELVGIGGLPNHATNVTRQAKKQNWEARAAKGVKGGGLEYHISSLSLETQRALRLQAALAEVKPPEMAQPKLNLDLVRKF… |
| C6SM66 | 1-173 | None |
| A0A2X3JF63 | 3-137 | None |
| A0A7V2EYC7 | 136-282 | None |
| A0A0P4UWQ3 | 92-258 | None |
| A0A840NVX7 | 1-136 | None |
| A0A837Q7U6 | 2-147 | None |
| A0A6S5WTF4 | 14-163 | None |
| A0A1G1FYI3 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.