DPCstruct | MC20572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8WR10 | 1-62 | MKKVILPLFLSIILLLTPALASAHPGRTDSKGGHYCRTNCEKWGLKKGEYHYHNSGTKKKKH |
| A0A1R0XI03 | 1-69 | MKRIIVPIFMSLFLLLMPVLAEAHPGRTDANGGHYCRTNCAKWGLENGEYHYHNGGGSDSKPAATFVRR |
| A0A1F8E3L6 | 3-65 | None |
| A0A1F6FH38 | 3-68 | None |
| A0A8A7GHR9 | 2-60 | None |
| A0A848M7Z2 | 1-114 | None |
| A0A371SAM5 | 1-53 | None |
| A0A3R9Q7H0 | 1-65 | None |
| A0A0G0RS65 | 1-60 | None |
| A0A078M8L2 | 14-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.