DPCstruct | MC20571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A009JJQ9 | 7-90 | IPLIDKLVKEKNFVLLTWDARYSSGAWACCLPYLNQCEVVYEASEDGDTLMIPKMEYLLNTNWLPIMDGSSAMDALEKLETRLA |
| A0A1R0X1E6 | 4-92 | NTIDKLVSNEGWNIQSWRFRYGTELWVIASPLAEQLDQIREITEGADIEAIELASYFNNEGSWLPVVSAKNISEGLEMLEQKIKVFE… |
| R2SQ81 | 9-99 | None |
| A0A2N7ISX0 | 2-85 | None |
| A0A0Q4QP43 | 1-83 | None |
| A0A0G3BDG2 | 5-82 | None |
| A0A2X1AAY9 | 3-82 | None |
| A0A290Q831 | 2-91 | None |
| A0A106PZH1 | 5-82 | None |
| R8UHN3 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.