DPCstruct | MC2057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3TEJ9 | 5-71 | ENQDLIAEELGIEVEELEQLRYDEGEHASEDGLIYYFYVTFKDGNPPAIMKKIQGLEGKMVRFDPSL |
| A0A4V2AS79 | 13-78 | TQYTAQLLGIPQEDLTAVNHSGLHTIIEGDGQVAQYYIQFDRNSDTSILNKLKLNKRYIAYFRPDE |
| A0A2S3UV49 | 6-81 | None |
| Q214U7 | 7-76 | None |
| A0A1H6NS12 | 1-96 | None |
| A0A075PAF6 | 13-83 | None |
| A0A0H4A4Z8 | 67-134 | None |
| A0A4R3E291 | 31-105 | None |
| A0A7X0J0T0 | 15-83 | None |
| A0A5E6N3F4 | 11-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.