DPCstruct | MC20566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 634 ± 95 aa |
| Standard deviation of domain lengths | 95.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.58 |
| Pfam Score | 64.10 |
| Assigned Pfam label(s) | CL0192- CL0144- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1WVF2 | 374-1066 | ILDERILFSEISFMETFYLEYYVGREPSKKNLLNLSPYFDKKKTQLSFHDPKILKDGYIDDQLYALPYEMDFDLLYYRHKDDVSNDL… |
| A0A1Y2AZE1 | 2-536 | YSPRYAPYFIDLGDWLPAEHMSHFSSGIATQSCKYKDKWVGLPITYEFNVLYCNTNLLKKHNKKIPKTWNELLEIGKYIRDNDENSN… |
| A0A1Y2GZD9 | 87-870 | None |
| A0A7S2EBZ9 | 71-586 | None |
| A0A433Q4L3 | 104-718 | None |
| A0A1Y2HQ57 | 29-764 | None |
| A0A1Y1VLT2 | 2-574 | None |
| A0A1Y1UWA0 | 3-736 | None |
| D3BL16 | 60-740 | None |
| A0A507FEG9 | 6-860 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.