DPCstruct | MC20565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Standard deviation of domain lengths | 14.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3C043 | 2-130 | VVTLLLENRPDSPIAFIAHYFRTVTQGSSPLLRAYRYIRLASPEQDAFTDNLVASYSALDSRRSSCGVIGSDLMKLLRLIGADCSLD… |
| A0A1Y1WUQ7 | 1-155 | MNKSDSTEYLDQTGITSLLQECISILLENKPENPFKVLNEHIKFYIQNDSSKIKTAIREIKLSHYIQSSTFTEHVASAYITLTKDNN… |
| F7BVX7 | 12-186 | None |
| R7TJC7 | 1-178 | None |
| A0A812DRU5 | 17-172 | None |
| A0A6J8D8Q0 | 1-144 | None |
| A0A452GXV5 | 2-140 | None |
| W4G0W3 | 1-160 | None |
| A0A3N0YZP6 | 9-182 | None |
| A0A1Y3N9A8 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.