DPCstruct | MC2056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6IEY5 | 29-184 | INQRSADVRYSALQKIADQNINKWIGDNIEEVRFLKECTWKVDDEIFFNTRKDRAYLLLLIQDNDTSAALDYVYVLYAAQNMSKWTI… |
| A0A4V1SNM4 | 1-173 | MNEQEQLECLNKMTATWRQDKVYKNVRSELDSTFNSWIDHDIKAVQYYRRTIWKVDETVFFNTSKNAAILLILQQDTNTNVYKDNVH… |
| A0A519P7S9 | 1-156 | None |
| A0A0C1FH54 | 2-153 | None |
| A0A1G6U001 | 25-203 | None |
| A0A4Q6EA97 | 35-172 | None |
| A0A821D7B1 | 236-408 | None |
| A0A2S1QTZ3 | 26-187 | None |
| A0A7V9NWF2 | 2-129 | None |
| A0A817T5T7 | 428-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.