DPCstruct | MC20558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 59 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 96.46 |
| Assigned Pfam label(s) | PF00082- PF00187- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0HV15 | 79-131 | AAPPAKLTITPDSTCGVRTGFKCAEGSCCGASGWCGSTPAHCGTGCHFAYGKC |
| A0A1Y1UW30 | 27-83 | KSSTSTTKLPISTNSSGKCGKGYGRCSSGYCCSKYGYCGKTSEYCGNGCQSEFGKCN |
| A0A1Y1XGH7 | 98-163 | None |
| A0A1Y1XHG3 | 112-173 | None |
| A0A1Y1XJF4 | 933-990 | None |
| A0A074W4W7 | 33-104 | None |
| A0A835YTT5 | 304-353 | None |
| A0A178DKG7 | 62-131 | None |
| A0A383VMG1 | 556-618 | None |
| A0A1Y1XDB5 | 278-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.