DPCstruct | MC20556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 225 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF20958- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9XXE6 | 487-694 | TLRKKIFSSMDKNSHCLGWGPDEHTNVSIASKYGVDVIASDWSYNLSVLSAFPSNPQKQKTNNYIDEDGVHYVTFIMSDGDNQQWLL… |
| R5ILE6 | 217-436 | FYTEILSWIQAPAPIVGWNEGDEGAHVELATKYGHFTTGATICNMPVLSAGASVRPVAVHKNMDPRHIDWADDSHFHSFVLSDGDNM… |
| A0A7X9J4R6 | 184-415 | None |
| R5JS85 | 290-523 | None |
| A0A1B8VYP0 | 213-427 | None |
| A0A847JVE6 | 362-616 | None |
| A0A7V0L3L1 | 8-236 | None |
| A0A7V2F0U8 | 102-324 | None |
| A0A7X8MCY8 | 13-252 | None |
| A0A7X6VQ54 | 1-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.