DPCstruct | MC20555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.16 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0004- CL0642 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5CAR6 | 1-91 | MEEGTLGYAVGSTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHTLGDTRLGQVSALPLPPAMKRY… |
| A0A182STY4 | 44-140 | FLVALDMDEGTLSFIVDGQYLGVAFKGLKGRKLYPIVSAVWGHCEITMKYIGGLDPEPLPLMDLCRRVIRQRIGRTYLEERIPNLAL… |
| S7PNV6 | 1-112 | None |
| A0A183FN34 | 107-204 | None |
| A0A194PU64 | 141-251 | None |
| A0A7R8CJT4 | 88-194 | None |
| U4PBQ2 | 85-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.