DPCstruct | MC20554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 135 ± 28 aa |
| Standard deviation of domain lengths | 27.75 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 38.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5C4I0 | 1-100 | MESAYLQKHLGTCLIQGLAEVARVRPVDPIEYLALWIYKYKENVTMEELRQKEMAQLEHERTLALVEQELLEKLRAEELLFQQEGAQ… |
| Q8WWB3 | 1-111 | MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLA… |
| A0A834CNS8 | 1-108 | None |
| A0A401SU48 | 37-226 | None |
| A0A3P8R982 | 1-154 | None |
| A0A2T7PZU9 | 1-166 | None |
| A0A6P8UB11 | 1-121 | None |
| A0A194RGT3 | 342-450 | None |
| A0A3B4AKW5 | 1-135 | None |
| H9G9N9 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.