DPCstruct | MC20550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2Z1J9 | 17-162 | SLPAFAAGPANNTNKATKAMSDSVQQTPNTGGVAPEDSAPAQGQSKLDIVVAGIRRSADSAKRVQSMTKVAFVQIVDVGSGEEAERQ… |
| A0A5E8A548 | 15-158 | GRLLAATILAGALAFSGLVQAQSFDSQDPSESIADSEISVAGTRAAERLEDLMASIENLPESVDRVKIITNMERIDVVYLSDMMDGG… |
| A0A2M9DBH7 | 196-340 | None |
| A0A1H3P2P3 | 227-374 | None |
| A0A316H752 | 1-136 | None |
| A0A7W2BP84 | 49-201 | None |
| A0A178HQS8 | 129-272 | None |
| A0A4Q3DV46 | 1-153 | None |
| A0A6N1VD03 | 2-110 | None |
| A0A0Q6PWZ2 | 74-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.