DPCstruct | MC20548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Standard deviation of domain lengths | 19.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2EEN4 | 23-189 | MGLDARVRCRCFEDGRLKPGPVPVTDLYIDEDGYLASRTLDTASIRYDWRRYHARYGKLDEEFTLWLEDCCEHENGEYCSEWIGTWG… |
| A0A3F3ACE6 | 1-158 | MSYGAFVHCRCFQDDKIPKPYFADFIKYDECGLYIYLPKELENNQEKSQDIFIDFYDWVEIACTHRNMYLSNQDVANIPTMNKFKNF… |
| A0A4Q7YJ92 | 1-153 | None |
| A0A4R5WHB1 | 1-127 | None |
| A0A4Q7KQC0 | 2-140 | None |
| A0A2T0JZI0 | 46-156 | None |
| A0A4Q5BGT1 | 1-178 | None |
| A0A6I5P780 | 1-150 | None |
| A0A2Z4RAT8 | 1-122 | None |
| A0A3N7GQ19 | 127-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.