DPCstruct | MC20544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 356 ± 67 aa |
| Standard deviation of domain lengths | 66.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8GVY6 | 41-306 | FESILDEKSSANAQQQQQMVEEVVTCLPYLVRVALANPAHSILFQKLHALPQLNSVLAYLALDIDAVEDPLEAELQRKRKTGSTNPA… |
| A0A7R8YWC8 | 10-405 | AFIAMQNLDIQMLATCNQHEIRPFLPSLVRMSLLFPMETTRGMMECRKQILVLLVGIEIVNNIVALLQVDYHELEVEVKKEQMLRQK… |
| A0A821PGY0 | 1-313 | None |
| A0A819PYN1 | 6-309 | None |
| A0A5K4ER73 | 2-459 | None |
| A0A3Q0KPJ6 | 4-459 | None |
| A0A7R8ZBB5 | 109-475 | None |
| S9XGQ4 | 256-512 | None |
| A0A6G0I956 | 12-433 | None |
| A0A158PPH8 | 1-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.