DPCstruct | MC20543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482WKR8 | 139-279 | KLIRHSIALVAVLMVMSFPVAPIKRVTSLRIALEHQVTAEDAMISALGIVPELMVNPGCKECSKSNETYCLGRDVIYDHCCCDRRFH… |
| A0A7R8YT65 | 10-165 | VLIINLCFVIDLIDSAVVNTILPPCEKLTLTKTERTYEEYHMEHQVTKQEAIASLRAINETFFNAALPLGCKAIPCNQSIMKYCLGP… |
| A0A6J1X4W5 | 1-133 | None |
| A0A482VBA5 | 21-148 | None |
| A0A834IQG3 | 58-212 | None |
| A0A2J7PCS3 | 3-116 | None |
| A0A0L7L3K0 | 5-114 | None |
| A0A1I8MBN8 | 5-152 | None |
| B4IYZ8 | 65-199 | None |
| A0A1Y9H9I5 | 41-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.