DPCstruct | MC20540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X7ZK91 | 2-80 | PPPPNCTAADLAGVSAGVAAATSAYLFTHPDVNDYFTSLKGQPREDIRDQLQQYMDANPAVHADLQGIRQPLTDFRNRC |
| G4I996 | 7-108 | LAVGVPGLAIADPAPNCTSADMAAIMSGVGFALSGYLYTHPDVNDYLTSLQGLPKEQIRAKVQDYLAANPQVRDDIKAIRQPANDFR… |
| A0A7Z0W5N5 | 1-95 | None |
| A0A1X0DDQ9 | 40-163 | None |
| A0A7I7V9W9 | 1-123 | None |
| A0A1A1XBN8 | 19-131 | None |
| A0A7I7K6V4 | 15-144 | None |
| A0A6N4V1C7 | 1-95 | None |
| A0A7W8CD18 | 27-149 | None |
| A0A1A0MLA2 | 6-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.