DPCstruct | MC2054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Standard deviation of domain lengths | 21.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6MGD3 | 2-106 | LRLALRRVSSSSSSTATTTAVINSSSRFITGSASKPSLSIWRRKKELGKEGLIITKELKRLQSDPVRLDRFVRSNVSRLLKSDLVSV… |
| A0A2T8I6J7 | 16-164 | RFQMFSRLLPHRHSHHRRLLQTLPCAAAKSAAEVDLHQRPCSTTAASSPSLSIWRRKKEMGKEGLMAVAQLKRLAALTTAGGHPRLE… |
| A0A4U6WBR9 | 1-165 | None |
| A0A438G1Q3 | 3-165 | None |
| A0A5N6PBT3 | 1-105 | None |
| A0A5D3BE11 | 242-407 | None |
| D8S3Q8 | 29-176 | None |
| A0A6D2IN71 | 1-165 | None |
| A0A5D3DWI7 | 1-125 | None |
| A0A804JQ47 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.