DPCstruct | MC20539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.13 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF00330- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4I859 | 1-121 | MNYLASPPLVVAYALAGTMDIDFATEPLGHTADGTPVLLTDLWPEPDEIRAVIEGSLSAEMFTAAYRDVFTGDQRCRGIDVASSEMF… |
| A0A6A4IZ81 | 184-284 | NYLASPLLVIAYAIAGRVDIDFETEPIGTGTNGKNVFLRDIWPSRAEIQAVEKASVIPAMFRDVYSRIENGSNAWRSLEAPEGKLYP… |
| A0A7Y5SIJ0 | 18-120 | None |
| A0A7U0YJL2 | 228-329 | None |
| A0A4C1WIK5 | 96-206 | None |
| A0A812QJH8 | 257-360 | None |
| A0A6N3U8Q5 | 1-94 | None |
| A0A6P6BZ23 | 549-638 | None |
| A0A447QV26 | 341-449 | None |
| A0A376SMW9 | 244-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.