DPCstruct | MC20537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 264 ± 22 aa |
| Standard deviation of domain lengths | 21.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F8U1 | 196-444 | FQKFLDELHDHGQLHSMSSWMEMYPTLSSDMRFSGMLGQPGSTPLDLFKFYVEDLKARYHDEKRIIKDILKDKGFLVEVNTSFDDFG… |
| A0A0L1I7X0 | 22-259 | AAWEDFYEKYHNDTRYTDILGHQGSSPRILFDEFIDSLQEQYLIHKSYIKKAYKEMDFTIDENITLEDFLKTFSNVQSKYNIPDANM… |
| A0A178VDJ1 | 121-377 | None |
| A0A816RR43 | 682-953 | None |
| A0A058Z802 | 669-955 | None |
| A0A0N5APW2 | 481-745 | None |
| A0A821G504 | 196-454 | None |
| A0A811VC32 | 2-240 | None |
| A0A3L8DT58 | 915-1143 | None |
| V7BDZ4 | 445-733 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.