DPCstruct | MC20536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 194 ± 32 aa |
| Standard deviation of domain lengths | 31.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.97 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | PF14355- CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087DI48 | 1-116 | MPQDIASAASEAYACFSINANRAAVLLARTAVQAIAKDKNIHTNNLYGDIEKMAETHVVTDQLKDEAHEIRFIGNDMAHGDLGTPVD… |
| A0A318E3X2 | 23-224 | SISTVCPHCGEKGVFALGSAVDDTARMAVASTARCPGCNRPVHFWAVRHEQKPKEDKNNPAAVYMYPVAKNHYPNPEFAPDIPEPLQ… |
| A0A2T3G286 | 48-273 | None |
| A0A4Q0IJS7 | 11-197 | None |
| A0A7W7Z906 | 23-182 | None |
| A0A496SVF8 | 36-236 | None |
| A0A1F9HWW8 | 1-158 | None |
| A0A7K2B3M7 | 20-216 | None |
| A0A2S7E563 | 7-137 | None |
| A0A0Q2UA64 | 35-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.