DPCstruct | MC20534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 220 ± 27 aa |
| Standard deviation of domain lengths | 26.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380EKZ7 | 2-158 | KKLCFGTFATILKICSAKRISQKLLCGTMLLSIAPTYDIRGEDGTVSDLILGKKNLSPNITDKAPTVDPRAVSNYFKQHILNMLDSN… |
| A0A1Z7M2C1 | 1-219 | MDGETPIRFCGGIFFTLILKARKKPVRNQEEILKDLLVIFDRGVKGMYGNTLTTYASKFKNCDPDLDTEYIKFGDEVVLAAFNDRLK… |
| A0A098B3M2 | 1-239 | None |
| A0A3E2N9J4 | 2-175 | None |
| A0A1C5SK14 | 3-243 | None |
| A0A374VUE5 | 3-229 | None |
| A0A2N6SG74 | 1-230 | None |
| A0A373B625 | 1-227 | None |
| I0RBE5 | 1-240 | None |
| R5VPE0 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.