DPCstruct | MC2053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287FKZ3 | 15-136 | EPRQWPGGRPGLGSVALELACKVLCVVATCAFAAVGSLVGAVSGSVIGLATESGVVRGAGIGAISGAVFSIEVAESSRDLWHTSDSA… |
| A0A2S3IP00 | 2-126 | DLPPSPSSAPEPCQWAGAGLGSAACGLAGRVLCVVATCVFAAVGSLVGAVTGSMIGLATESGVLRGAGIGAISGAVFSIEVAEASRD… |
| A0A0D3BEC7 | 1-137 | None |
| A0A067KKV3 | 15-129 | None |
| A0A287XXW7 | 1-115 | None |
| A0A287FL30 | 1-118 | None |
| A0A7I8JTM4 | 4-104 | None |
| M0ZW82 | 5-144 | None |
| A0A427BCM4 | 93-216 | None |
| A0A835PAM3 | 14-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.