DPCstruct | MC20527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 344 |
|---|---|
| Mean domain length (aa) | 173 ± 35 aa |
| Standard deviation of domain lengths | 34.83 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.42 |
| Pfam Score | 84.98 |
| Assigned Pfam label(s) | PF20381- PF04011- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0YUY6 | 2-124 | KWFEDRLSGFYQKYGGEIVIVTLKSTKPIKPSEYVFWLFNRWDIGGEKNAGIMILLALSERRIESEVGYSYEHIISDVESGQVLDDY… |
| A0A2W1JKF9 | 20-206 | IASSTLPAIAVSIEQVPNPRQNNGGWVTDMADVLSAPTELKLNQMISELEAENSSEIAVVTVPETSPSKSPKTFATELFNTWGIGKK… |
| A0A354NFZ3 | 21-159 | None |
| R5VV64 | 29-232 | None |
| A0A3D3NPP8 | 32-192 | None |
| A0A2R3MX68 | 38-170 | None |
| A0A323V5A3 | 27-173 | None |
| R6QM81 | 72-314 | None |
| A0A2Z5TF40 | 1-112 | None |
| A0A3E1EG62 | 31-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.