DPCstruct | MC20524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 206 ± 23 aa |
| Standard deviation of domain lengths | 23.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098TJL2 | 1-201 | MSPLDDVTLIRKFVQGDTTLLGNQNLRVETAFDASQLIAKRGGIVATLKTEQGRTVLVRQSSEYWALLHQVLCDSSLVPTSPAAQKG… |
| A0A2W1J642 | 12-203 | SPRYTNEELIQHFVKGFTQGNPPSLSNSTLQTKALQQGVQLLAGHDAILTAYWQDPPLRAVVKHTTPYGELIKQALLAESFYPLSQT… |
| A0A838VKF4 | 1-157 | None |
| B0C6H2 | 1-196 | None |
| A0A0S3TYD2 | 1-180 | None |
| A0A1Z4JXB8 | 7-219 | None |
| B8HXI9 | 68-290 | None |
| A0A6I5NM52 | 18-226 | None |
| K9UAN6 | 2-255 | None |
| K9VXN9 | 1-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.