DPCstruct | MC2052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 175 ± 31 aa |
| Standard deviation of domain lengths | 31.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.11 |
| Pfam Score | 77.54 |
| Assigned Pfam label(s) | PF04855- CL0167- CL0281- PF06200 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3R9T5 | 11-105 | AHRAASLSRFRQKRKRRCFANKIRYKTRQEATLRVHRSKSQFILSKIHESEQDVFHSEILCCNCGISSKCTPMMRRGPSGPASLCNA… |
| A0A2S3IEK3 | 10-157 | FDSVPPQKVQPIVVPRDFDRTAAVSRYREKRKSTLKFDVKADYSIRREIASRIARRRGKFVSSGKSSENSAAAAARRRQGETTELEQ… |
| A0A7J0EHR2 | 43-236 | None |
| A0A835E3N8 | 77-278 | None |
| M1VIN6 | 161-344 | None |
| A0A7I4C222 | 86-276 | None |
| M7YI93 | 49-186 | None |
| A0A453SQ67 | 56-236 | None |
| A0A7J9FVL8 | 25-217 | None |
| A0A7I8JVS0 | 71-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.