DPCstruct | MC20519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 52 ± 2 aa |
| Standard deviation of domain lengths | 1.98 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 50.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WVL9 | 74-124 | WFVLRKYGIKGLQNHVREGVRLAGKFEALVLSDGRFEIPAKRHLGLVVFRL |
| A0A7R9R296 | 2-52 | WFVFRSYGIKGLQNYIRKHVVLAKHFESLLAKDDRFELTAPVELSLICFRL |
| A0A3S3PHU9 | 189-246 | None |
| A0A814C9Q1 | 23-74 | None |
| A0A212CL36 | 84-135 | None |
| A0A287K0H2 | 60-110 | None |
| A0A438H5D6 | 195-245 | None |
| E0VCM6 | 20-70 | None |
| A0A504YKT2 | 269-319 | None |
| A0A1V4JW58 | 22-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.