DPCstruct | MC20518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 250 ± 59 aa |
| Standard deviation of domain lengths | 59.07 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 69.37 |
| Assigned Pfam label(s) | CL0125- CL0416- PF16178- PF06025- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0NZ68 | 17-221 | VDYVVLYRFSSIDKNEAKEQFKKLIRALSDVGLQTEVRPGIDQSLLIFVKAQEKYLGKALYRSRVRDWLHGVRNSQPDPDAKGSCIP… |
| A0A7R9QZC1 | 15-270 | IDFVLVFRTKDVKLSEDMSKSRQIYEQNLIEEGLILEYTDSIGSGEYTYVHIFAPWDLLTRYAEVMKLRMPMKTIQSNMKVLFDEEY… |
| A0A1A7XS53 | 30-280 | None |
| A0A6I9YYE0 | 25-279 | None |
| A0A067BRW1 | 34-288 | None |
| A0A672PXH2 | 15-290 | None |
| A0A0D8XGL6 | 24-265 | None |
| A0A183MKS1 | 36-282 | None |
| W4GQA4 | 23-228 | None |
| A0A2A2K345 | 8-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.