DPCstruct | MC20516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 254 ± 52 aa |
| Standard deviation of domain lengths | 52.33 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353DAN9 | 5-257 | VAVISEVLLERLAGREVDVDNGTALYHGLLFAMLLPATAPWWLVTAGAFCTIALGRTVFGGFGANPFCPPLVGWAVCAVSWERFLDL… |
| A0A2H0SX09 | 6-260 | PAEITTLYLVFLYVLAVSLKASPEFLMHEAIRFSLIGLGFLAPTLGWLKLKKQHIQWDNILITFLILLILADPTANHILSFALGLGT… |
| A0A535EUD9 | 137-340 | None |
| F4V2G9 | 2-243 | None |
| A0A6J4HQR0 | 31-329 | None |
| A0A376V9W7 | 2-247 | None |
| A0A243UYQ0 | 4-249 | None |
| F3ZMH4 | 2-248 | None |
| A0A1G1Q9L1 | 48-287 | None |
| A0A2A2KHM0 | 171-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.