DPCstruct | MC20514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 23.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349HIT1 | 4-150 | YYPDDVRLKKIAARCGTMAQSGQYNLLRTAKRGDAVASLQALSKFVEATLSLQFLLSKKYMPFYKWSFRACLDLPIAQRVLLKLREL… |
| A0A846PC79 | 82-274 | TSDWLRFPEHRLLEIAKGKIFHDDLDLNKIRKKFAYYPRDIWLHLLSLQWYRISQEEAFVSRCGDVGDELGSRLIASRQVNRLMKLC… |
| A0A1V5H5R3 | 2-121 | None |
| D6T0H8 | 281-435 | None |
| A0A352UPU2 | 1-141 | None |
| A0A087ALL8 | 786-930 | None |
| A0A359JI99 | 387-525 | None |
| A0A7X9GG27 | 126-293 | None |
| A0A6I5MYC4 | 625-832 | None |
| A0A3D2W9E5 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.